PredBALB/c Input Sequence Format

When the input sequence type is "Protein sequence"
The input sequence is treated as a contiguous protein sequence (carriage returns and line breaks will be ignored). The protein sequence is divided into overlapping 9-mer peptides for prediction.
MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVC
DKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWT
GRCMSCCRSSRTRRETQL
When the input sequence type is "a list of peptide sequences"
The input sequences separated by carriage returns or line breaks are treated as different peptides. Each peptide will be divided into 9-mer peptides for prediction.
KMNIQFTAVA
VLLVSLGAI
LLTEVETPI
GLISLILQI
RLIQNSLTI
FLWHVRKRV
ALKMTMASV
RLNKRSYLI
GMFNMLSTV
NMLSTVLGV
WMMAMKYPI
AHHAHHAADAHHAAD
IMDQVPFSV